DDX31 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131778
Article Name: DDX31 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131778
Supplier Catalog Number: orb2131778
Alternative Catalog Number: BYT-ORB2131778-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX31
Conjugation: Biotin
Alternative Names: PPP1R25
DDX31 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 619526
UniProt: Q9H8H2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS