TWNK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131790
Article Name: TWNK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131790
Supplier Catalog Number: orb2131790
Alternative Catalog Number: BYT-ORB2131790-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEO1
Conjugation: Biotin
Alternative Names: PEO, PEO1, SCA8, ATXN8, IOSCA, PEOA3, SANDO, TWINL, MTDPS7, PRLTS5, C10orf2
TWNK Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 068602
UniProt: Q96RR1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL