DDX55 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131802
Article Name: DDX55 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131802
Supplier Catalog Number: orb2131802
Alternative Catalog Number: BYT-ORB2131802-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX55
Conjugation: Biotin
DDX55 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 065987
UniProt: Q8NHQ9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVAT