DHX30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131853
Article Name: DHX30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131853
Supplier Catalog Number: orb2131853
Alternative Catalog Number: BYT-ORB2131853-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX30
Conjugation: Biotin
Alternative Names: DDX30, RETCOR, NEDMIAL
DHX30 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 129kDa
NCBI: 055781
UniProt: Q7L2E3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH