DHX34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131868
Article Name: DHX34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131868
Supplier Catalog Number: orb2131868
Alternative Catalog Number: BYT-ORB2131868-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHX34
Conjugation: Biotin
Alternative Names: HRH1, DDX34
DHX34 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 128kDa
NCBI: 919409
UniProt: Q14147
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD