RAD54B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131892
Article Name: RAD54B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131892
Supplier Catalog Number: orb2131892
Alternative Catalog Number: BYT-ORB2131892-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAD54B
Conjugation: Biotin
Alternative Names: RDH54
RAD54B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 036547
UniProt: Q9Y620
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN