DDX42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2131898
| Article Name: |
DDX42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2131898 |
| Supplier Catalog Number: |
orb2131898 |
| Alternative Catalog Number: |
BYT-ORB2131898-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX42 |
| Conjugation: |
Biotin |
| Alternative Names: |
RHELP, RNAHP, SF3B8, DDX42P, SF3b125 |
| DDX42 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
103kDa |
| NCBI: |
031398 |
| UniProt: |
Q86XP3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM |
