ZNF613 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132504
Article Name: ZNF613 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132504
Supplier Catalog Number: orb2132504
Alternative Catalog Number: BYT-ORB2132504-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF613
Conjugation: Biotin
Alternative Names: FLJ13590
ZNF613 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 001026891
UniProt: Q6PF04
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AFGNIIHQRKSDFPLRQNHDTFDLHGKILKSNLSLVNQNKRYEIKNSVGV