ZNF329 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132531
Article Name: ZNF329 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132531
Supplier Catalog Number: orb2132531
Alternative Catalog Number: BYT-ORB2132531-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF329
Conjugation: Biotin
Alternative Names: FLJ12586
ZNF329 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 078896
UniProt: Q86UD4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GDGWDCENQEGHLRQSALTLEKPGTQEAICEYPGFGEHLIASSDLPPSQR