FLJ12644 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132558
Article Name: FLJ12644 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132558
Supplier Catalog Number: orb2132558
Alternative Catalog Number: BYT-ORB2132558-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ12644
Conjugation: Biotin
FLJ12644 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 075562
UniProt: Q9H9N2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV