ZNF530 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132627
Article Name: ZNF530 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132627
Supplier Catalog Number: orb2132627
Alternative Catalog Number: BYT-ORB2132627-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF530
Conjugation: Biotin
Alternative Names: KIAA1508
ZNF530 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 065931
UniProt: Q6P9A1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VEELSQGRTPKADTSTDKSHPCEICTPVLRDILQMIELHASPCGQKLYLG