PRDM9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132648
Article Name: PRDM9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132648
Supplier Catalog Number: orb2132648
Alternative Catalog Number: BYT-ORB2132648-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM9
Conjugation: Biotin
Alternative Names: PFM6, KMT8B, MSBP3, ZNF899, MEISETZ
PRDM9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 064612
UniProt: Q9NQV7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP