ZNF446 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132696
Article Name: ZNF446 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132696
Supplier Catalog Number: orb2132696
Alternative Catalog Number: BYT-ORB2132696-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF446
Conjugation: Biotin
Alternative Names: ZSCAN30, ZSCAN52, ZKSCAN20
ZNF446 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 060378
UniProt: Q9NWS9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGNHGHQEPASTSFHPPR