FEV Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132717
Article Name: FEV Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132717
Supplier Catalog Number: orb2132717
Alternative Catalog Number: BYT-ORB2132717-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FEV
Conjugation: Biotin
Alternative Names: PET-1, HSRNAFEV
FEV Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 059991
UniProt: Q99581
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: APAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHY