ZNF337 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132768
Article Name: ZNF337 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132768
Supplier Catalog Number: orb2132768
Alternative Catalog Number: BYT-ORB2132768-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF337
Conjugation: Biotin
ZNF337 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 056470
UniProt: Q9Y3M9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KPFVCQECKRGYTSKSDLTVHERIHTGERPYECQECGRKFSNKSYYSKHL