ZNF432 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132789
Article Name: ZNF432 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132789
Supplier Catalog Number: orb2132789
Alternative Catalog Number: BYT-ORB2132789-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF432
Conjugation: Biotin
ZNF432 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 055465
UniProt: O94892
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSL