VSX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132798
Article Name: VSX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132798
Supplier Catalog Number: orb2132798
Alternative Catalog Number: BYT-ORB2132798-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VSX1
Conjugation: Biotin
Alternative Names: PPD, KTCN, PPCD, RINX, KTCN1, PPCD1, CAASDS
VSX1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 055403
UniProt: Q9NZR4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK