VENTX Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132807
Article Name: VENTX Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132807
Supplier Catalog Number: orb2132807
Alternative Catalog Number: BYT-ORB2132807-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VENTX
Conjugation: Biotin
Alternative Names: NA88A, HPX42B, VENTX2
VENTX Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 055283
UniProt: O95231
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE