ZNF146 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132894
Article Name: ZNF146 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132894
Supplier Catalog Number: orb2132894
Alternative Catalog Number: BYT-ORB2132894-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF146
Conjugation: Biotin
Alternative Names: OZF
ZNF146 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 009076
UniProt: Q15072
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKA