ZNF234 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132939
Article Name: ZNF234 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132939
Supplier Catalog Number: orb2132939
Alternative Catalog Number: BYT-ORB2132939-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF234
Conjugation: Biotin
Alternative Names: HZF4, ZNF269
ZNF234 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 006621
UniProt: Q14588
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KGFKWSLNLDMHQRVHTGEKPYTCGECGKHFSQASSLQLHQSVHTGEKPY