HMG20B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2132954
| Article Name: |
HMG20B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2132954 |
| Supplier Catalog Number: |
orb2132954 |
| Alternative Catalog Number: |
BYT-ORB2132954-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human HMG20B |
| Conjugation: |
Biotin |
| Alternative Names: |
SOXL, HMGX2, BRAF25, BRAF35, HMGXB2, PP7706, pp8857, SMARCE1r |
| HMG20B Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
37kDa |
| NCBI: |
006330 |
| UniProt: |
Q9P0W2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: AELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQ |
