CHST4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132978
Article Name: CHST4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132978
Supplier Catalog Number: orb2132978
Alternative Catalog Number: BYT-ORB2132978-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHST4
Conjugation: Biotin
Alternative Names: GST3, LSST, GlcNAc6ST2, HECGLCNAC6ST
CHST4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 005760
UniProt: Q8NCG5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVR