HMGB3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2133014
| Article Name: |
HMGB3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2133014 |
| Supplier Catalog Number: |
orb2133014 |
| Alternative Catalog Number: |
BYT-ORB2133014-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB3 |
| Conjugation: |
Biotin |
| Alternative Names: |
HMG4, HMG-4, HMG2A, HMG-2a |
| HMGB3 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
23kDa |
| NCBI: |
005333 |
| UniProt: |
O15347 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE |