DLX6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133020
Article Name: DLX6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133020
Supplier Catalog Number: orb2133020
Alternative Catalog Number: BYT-ORB2133020-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DLX6
Conjugation: Biotin
DLX6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 376652
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS