PLA2G4B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133029
Article Name: PLA2G4B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133029
Supplier Catalog Number: orb2133029
Alternative Catalog Number: BYT-ORB2133029-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G4B
Conjugation: Biotin
Alternative Names: HsT16992, cPLA2-beta
PLA2G4B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 114kDa
NCBI: 005081
UniProt: P0C869
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD