ZNF45 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133167
Article Name: ZNF45 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133167
Supplier Catalog Number: orb2133167
Alternative Catalog Number: BYT-ORB2133167-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF45
Conjugation: Biotin
Alternative Names: KOX5, ZNF13
ZNF45 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 003416
UniProt: Q02386
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHL