SLC18A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133185
Article Name: SLC18A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133185
Supplier Catalog Number: orb2133185
Alternative Catalog Number: BYT-ORB2133185-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A1
Conjugation: Biotin
Alternative Names: CGAT, VAT1, VMAT1
SLC18A1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 003044
UniProt: P54219
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL