FOXJ1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133206
Article Name: FOXJ1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133206
Supplier Catalog Number: orb2133206
Alternative Catalog Number: BYT-ORB2133206-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXJ1
Conjugation: Biotin
Alternative Names: HFH4, HFH-4, CILD43, FKHL13
FOXJ1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 001445
UniProt: Q92949
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFD