TRPM3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133239
Article Name: TRPM3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133239
Supplier Catalog Number: orb2133239
Alternative Catalog Number: BYT-ORB2133239-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence DISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQ
Conjugation: Biotin
Alternative Names: GON-2, MLSN2, LTRPC3
TRPM3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 198 kDa
NCBI: 996827
UniProt: Q9HCF6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQ