CACNA1G Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2133299
| Article Name: |
CACNA1G Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2133299 |
| Supplier Catalog Number: |
orb2133299 |
| Alternative Catalog Number: |
BYT-ORB2133299-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G |
| Conjugation: |
Biotin |
| Alternative Names: |
NBR13, SCA42, Cav3.1, SCA42ND, Ca(V)T.1 |
| CACNA1G Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
241kDa |
| NCBI: |
938202 |
| UniProt: |
O43497 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS |
