KCNH7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133404
Article Name: KCNH7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133404
Supplier Catalog Number: orb2133404
Alternative Catalog Number: BYT-ORB2133404-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH7
Conjugation: Biotin
Alternative Names: ERG3, HERG3, Kv11.3
KCNH7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 775185
UniProt: Q8IV15
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV