CACNA1I Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133647
Article Name: CACNA1I Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133647
Supplier Catalog Number: orb2133647
Alternative Catalog Number: BYT-ORB2133647-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNA1I
Conjugation: Biotin
Alternative Names: Cav3.3, ca(v)3.3
CACNA1I Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 245kDa
NCBI: 001003406
UniProt: Q9P0X4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS