TRPM4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133698
Article Name: TRPM4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133698
Supplier Catalog Number: orb2133698
Alternative Catalog Number: BYT-ORB2133698-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4
Conjugation: Biotin
Alternative Names: EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4
TRPM4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 134kDa
NCBI: 060106
UniProt: Q8TD43
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI