TRPV2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2133734
Article Name: TRPV2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133734
Supplier Catalog Number: orb2133734
Alternative Catalog Number: BYT-ORB2133734-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRPV2
Conjugation: Biotin
Alternative Names: VRL, VRL1, VRL-1
TRPV2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 84 kDa
NCBI: 057197
UniProt: Q9Y5S1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EDEGNGAQYRGILEASLELFKFTIGMGELAFQEQLHFRGMVLLLLLAYVL