TRIM14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134448
Article Name: TRIM14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134448
Supplier Catalog Number: orb2134448
Alternative Catalog Number: BYT-ORB2134448-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM14
Conjugation: Biotin
TRIM14 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 150090
UniProt: Q5TBQ8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV