KLHL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134598
Article Name: KLHL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134598
Supplier Catalog Number: orb2134598
Alternative Catalog Number: BYT-ORB2134598-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLHL6
Conjugation: Biotin
Alternative Names: KLHL6,
KLHL6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 569713
UniProt: Q8WZ60
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VGILRLADTHSLDSLKKQVQSYIIQNFVQILNSEEFLDLPVDTLHHILKS