ADPGK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134646
Article Name: ADPGK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134646
Supplier Catalog Number: orb2134646
Alternative Catalog Number: BYT-ORB2134646-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADPGK
Conjugation: Biotin
Alternative Names: ADP-GK, 2610017G09Rik
ADPGK Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 112574
UniProt: Q9BRR6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV