BTBD14A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134658
Article Name: BTBD14A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134658
Supplier Catalog Number: orb2134658
Alternative Catalog Number: BYT-ORB2134658-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD14A
Conjugation: Biotin
Alternative Names: RBB, BEND9, NAC-2, BTBD14, BTBD31, BTBD14A
BTBD14A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 653254
UniProt: Q96BF6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQ