KLHL26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134763
Article Name: KLHL26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134763
Supplier Catalog Number: orb2134763
Alternative Catalog Number: BYT-ORB2134763-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL26
Conjugation: Biotin
Alternative Names: FLJ11078
KLHL26 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 060786
UniProt: Q53HC5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QVLPFRQHEMQSPRTAVRSDVPSLVTFGGTPYTDSDRSVSSKVYQLPEPG