SMARCA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134886
Article Name: SMARCA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134886
Supplier Catalog Number: orb2134886
Alternative Catalog Number: BYT-ORB2134886-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA1
Conjugation: Biotin
Alternative Names: SWI, ISWI, SWI2, SNF2L, SNF2L1, SNF2LB, SNF2LT, hSNF2L, NURF140
SMARCA1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 120kDa
NCBI: 620604
UniProt: P28370
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QEEGAAAAATEATAATEKGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYE