Klhl1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2134982
Article Name: Klhl1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2134982
Supplier Catalog Number: orb2134982
Alternative Catalog Number: BYT-ORB2134982-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Klhl1
Conjugation: Biotin
Klhl1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 001099524
UniProt: D4A9J8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KPSSSSTSSSSSSSASSSPFSPLNGTLLPVATRLQQGAPGQGTQQPARTL