TRIM24 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135018
Article Name: TRIM24 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135018
Supplier Catalog Number: orb2135018
Alternative Catalog Number: BYT-ORB2135018-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM24
Conjugation: Biotin
Alternative Names: PTC6, TF1A, TIF1, RNF82, TIF1A, hTIF1, TIF1ALPHA
TRIM24 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 056989
UniProt: O15164
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIK