HOXB7 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2135101
| Article Name: |
HOXB7 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2135101 |
| Supplier Catalog Number: |
orb2135101 |
| Alternative Catalog Number: |
BYT-ORB2135101-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IF, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7 |
| Conjugation: |
FITC |
| Alternative Names: |
HOX2, HOX2C, HHO.C1, Hox-2.3 |
| HOXB7 Antibody - C-terminal region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
24kDa |
| NCBI: |
004493 |
| UniProt: |
P09629 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE |
