NFKBIB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135126
Article Name: NFKBIB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135126
Supplier Catalog Number: orb2135126
Alternative Catalog Number: BYT-ORB2135126-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFKBIB
Conjugation: Biotin
Alternative Names: IKBB, TRIP9
NFKBIB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 002494
UniProt: Q15653
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL