PTHLH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135861
Article Name: PTHLH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135861
Supplier Catalog Number: orb2135861
Alternative Catalog Number: BYT-ORB2135861-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTHLH
Conjugation: Biotin
Alternative Names: HHM, PLP, BDE2, PTHR, PTHRP
PTHLH Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 002811
UniProt: P12272
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS