KIF5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2135897
| Article Name: |
KIF5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2135897 |
| Supplier Catalog Number: |
orb2135897 |
| Alternative Catalog Number: |
BYT-ORB2135897-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human KIF5A |
| Conjugation: |
Biotin |
| Alternative Names: |
NKHC, ALS25, MY050, NEIMY, SPG10, D12S1889 |
| KIF5A Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
117kDa |
| NCBI: |
004975 |
| UniProt: |
Q12840 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH |
