SPINK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135900
Article Name: SPINK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135900
Supplier Catalog Number: orb2135900
Alternative Catalog Number: BYT-ORB2135900-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPINK1
Conjugation: Biotin
Alternative Names: TCP, PCTT, PSTI, TATI, Spink3
SPINK1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 003113
UniProt: P00995
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG