A1BG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135984
Article Name: A1BG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135984
Supplier Catalog Number: orb2135984
Alternative Catalog Number: BYT-ORB2135984-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human A1BG
Conjugation: Biotin
Alternative Names: A1B, ABG, GAB, HYST2477
A1BG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 570602
UniProt: P04217
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELS