XK Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2135997
Article Name: XK Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135997
Supplier Catalog Number: orb2135997
Alternative Catalog Number: BYT-ORB2135997-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XK
Conjugation: HRP
Alternative Names: KX, NA, NAC, X1k, XKR1
XK Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 066569
UniProt: P51811
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKE