TNKS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136068
Article Name: TNKS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136068
Supplier Catalog Number: orb2136068
Alternative Catalog Number: BYT-ORB2136068-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNKS
Conjugation: Biotin
Alternative Names: TIN1, ARTD5, PARPL, TINF1, TNKS1, pART5, PARP5A, PARP-5a
TNKS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 142kDa
NCBI: 003738
UniProt: O95271
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST